Protein Info for Dsui_0624 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 56% identity to eba:ebA6257)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG13 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Dsui_0624 hypothetical protein (Dechlorosoma suillum PS)
MNAPHRGGLRPLQRLPLLLLAMAALLVGVGGGLWRLGWAFPLPASLAAQGAAFHGPLMVS
AFFGTVIALERAVALATGWAYLGPALAGAAGLALLLGAPPAVAGGLACGAAAILLLASLR
VWRQQPALHNLTLALGAASWLLGNGLWLAGFPVPRVVIAWVAFLALTIAGERLELSRFLP
PSPLAQRFFALFMALVLLGALLTPLLPDAGTALAGLGLLALALWLLKQDIARRTVKQQGL
TRFIAVCLLSGYFWLALGGGLLLSGGALSGSGPHYDAALHALLVGFVFSMVFGHAPIIFP
AVARVQIPYHPVFYGPLLVLHGSLALRLLGDLLPESGLRPWGGAGNGLALLLFVLTMVGS
VIRGRRAAP