Protein Info for Dsui_0619 in Dechlorosoma suillum PS

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07715: Plug" amino acids 140 to 238 (99 residues), 74.9 bits, see alignment E=1.1e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 142 to 784 (643 residues), 389.7 bits, see alignment E=1.5e-120 PF00593: TonB_dep_Rec_b-barrel" amino acids 337 to 755 (419 residues), 171.4 bits, see alignment E=9.5e-54

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 48% identity to dar:Daro_1834)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG08 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Dsui_0619 TonB-dependent siderophore receptor (Dechlorosoma suillum PS)
MKKMMGMVALVTAAVAGNSWAQGARTLDLAPQPLAEALQGLAGQTGIQILFDAAELQSAR
SRGLQGSLTPEAALQKLLQDTDFVFHSTAPGSYVIQRRSRSGNVLPEVLVHGQRLRAETE
GSGTYAAAAATVAGKVALTPREIPQSVSVLTRQQMDDQGMVTMVDALQQVTGVNVIANDT
TQSQYLSRGFSLGVMQDGVSSHSGLTAVHQFDLALYDRVEVLRGPAGILQGTSEPGGVVN
LVKKRPRDTFAAAVTASTGSWNNNRVEGDITAPLNAERSLRGRLVVSDEDRQYYYDRART
NKWLAFGALEYDLSPATTLSLSFAAQDSRSKAPSSGLPKYKDGNFLKVDRSTNVVPDWVV
YSYYTEETSASVEHRFANKWVAKASYSHRTQNSFSKDAWPSSGVNRATGTVDAYNRSQYT
SDDRRDGLDAFINGPFDLFGRTHNLLLGVNAEVYNSRSKSGSASTVANVSLADAASLPEP
SFTYTSGSESERAQSGVYSQLRLSLADPVTLVLGGRATNFKAKSRNVSPSTQSAWRDGAQ
ANNQFTPYGGLIVDVTRQISLYGSYADIFVPQTQLKADGNALDPRVGKQYEVGSKGEFFD
GRLNASLAFFNIRDKNRAYRDPAYPAASTPYYLNAGEIESKGWEAEVSGSPMAGLELMAG
YTRLETRYLSDRTLQGKEYSIQSPRDSLKLWANYRFNQDSLRGLNLGLGTIVSSGAGSSR
GNRNVETQGGYAVVNALVGYQIDKNYTVSLAANNLFDRNYYATVGTFTAYNFYGEPRNLM
LTFRARY