Protein Info for Dsui_0617 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 52 to 73 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 60% identity to dar:Daro_1840)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG06 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Dsui_0617 hypothetical protein (Dechlorosoma suillum PS)
MLFQPSVIALLLAATLSLVMVAAAAPFAWQILRCWDLGSGSELQLQLERRTYLFSTLAAF
VCASQLLALLLFVFTADRLSAMFVGAMCAVGALNADARGFPALLLQVVLFFLAALWLVLN
HVDTRARNYPLVRLKYALLLGLTPLLALSAWLQWSYFRGLKADIITSCCGSLFSGDSNHG
VAGEMAGLAPLPAMLWFYGSLGLAALLTAWHAWSGRLGLLAGLSSGAAFVGGISGIVSFL
SLYLYEHPHHHCPFCILKPEYDYQGYALYLPLFAATAAGMGSGVLQLVCRVRGLEQIAPA
ASRRLATVAAWGFGLLLCLAAGMMAGSRLVLLEP