Protein Info for Dsui_0607 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details PF03653: UPF0093" amino acids 4 to 138 (135 residues), 141 bits, see alignment E=3.5e-45 PF05425: CopD" amino acids 47 to 135 (89 residues), 32.7 bits, see alignment E=8.5e-12

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 75% identity to dar:Daro_0281)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFZ6 at UniProt or InterPro

Protein Sequence (138 amino acids)

>Dsui_0607 putative membrane protein (Dechlorosoma suillum PS)
MLILKALHIILVASWFAGLFYLPRIFVNLAMVPADSTAERERLLLMARKLFRFMTPLGVL
ALVFGTWLWLGYGFAGGWLHAKLTLVLVLIGYHAYCGTLLKQFAAGTNRRSHVWFRWFNE
LPVLILFVVVFLVVLKPF