Protein Info for Dsui_0601 in Dechlorosoma suillum PS

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details PF02325: YGGT" amino acids 12 to 76 (65 residues), 55.6 bits, see alignment E=2.8e-19 amino acids 112 to 178 (67 residues), 59.8 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: K02221, YggT family protein (inferred from 51% identity to tmz:Tmz1t_3700)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFZ0 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Dsui_0601 putative integral membrane protein (Dechlorosoma suillum PS)
MLLDILNFLLDVVASFFGYLLLLRFVMQWRRVSFKNPLGHFVLQTTNWVVLPLRRAIPGL
FGLDFASLVPAWLLQAAVKAAMLAVKGGAALGAGALVTAALAMGFFELLHMAVMAAIVLM
LVQAVISWVNPHTPLAGPIHALTDPLLKPLRRIVPPIANVDLSPLVAIVLAQVLLMLLAY
VKAALMPLLF