Protein Info for Dsui_0597 in Dechlorosoma suillum PS

Annotation: dihydroorotase, multifunctional complex type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 20 to 413 (394 residues), 279.9 bits, see alignment E=1.8e-87 PF01979: Amidohydro_1" amino acids 206 to 413 (208 residues), 45.2 bits, see alignment E=7.7e-16 PF07969: Amidohydro_3" amino acids 323 to 383 (61 residues), 30 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 43% identical to PYRX_PSEAE: Dihydroorotase-like protein (pyrC') from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 62% identity to app:CAP2UW1_3596)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFY6 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Dsui_0597 dihydroorotase, multifunctional complex type (Dechlorosoma suillum PS)
MNISIKNGRLIDPKNGIDARQNLFIADGRIAAVGQPPAGFVPEREIDAAGYVVCPGLIDL
SARLPSLEAELACAAANGITTVVCPPDTRPVLDEPSLVERLIQRAEALGLARVLPLGALT
KGLQGQTLASMAGLASAGCVAFTQASQPVTDLQSLYRAMQYAATYDFAVWLRPQDYQLAK
DGVAHDGEMAARLGLAGIPVAAETVAIATLIELAKSTGVRLHLMRLSSAAGVAMVREAKA
RGVAVSCDVAAHHLHLAEEDIGYFNAQARFDPPLRSQADRAALRFGLAEGVIQAVCSDHT
PMEADGKQVPFGEAEVGARGLELLLPLVLAWAREDGLSLGTALARVTSDAAAVIGRSDLG
HLAVGAVADVCVFDAETEWTITPDAFTSVGRNSPLAGRTMSGRIQAVVAGGRLL