Protein Info for Dsui_0595 in Dechlorosoma suillum PS

Annotation: pyrimidine operon attenuation protein/uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00156: Pribosyltran" amino acids 10 to 137 (128 residues), 55.8 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 56% identical to PYRR_RALSO: Bifunctional protein PyrR (pyrR) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02825, pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 70% identity to dar:Daro_3891)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9) / Pyrimidine operon regulatory protein PyrR" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFY4 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_0595 pyrimidine operon attenuation protein/uracil phosphoribosyltransferase (Dechlorosoma suillum PS)
MPEAIPTQLPDAELQLASLAEQLRPHLTPDTALVGIYSGGAWVAERLKQLLDIREEVGQI
DVSFYRDDFAEKGLHPQVRPSHIPFEVEGRPLILVDDVLYTGRTTRAAINELFDYGRPAR
VELAVLADRGERELPIEPGYCVWEVDLEEGEELILGREESGRLFWKMGRNDRG