Protein Info for Dsui_0585 in Dechlorosoma suillum PS

Annotation: ABC-type metal ion transport system, periplasmic component/surface adhesin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01297: ZnuA" amino acids 22 to 293 (272 residues), 142 bits, see alignment E=1.3e-45

Best Hits

KEGG orthology group: K02077, zinc/manganese transport system substrate-binding protein (inferred from 63% identity to dar:Daro_0199)

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFX4 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Dsui_0585 ABC-type metal ion transport system, periplasmic component/surface adhesin (Dechlorosoma suillum PS)
MQRLIVLLLLAFTLPAQAALNVLATVPEWAALVKEIGGDKVNVVAATNGLQDPHRIEAKP
SLIARGRNAQLLVATGAELEVGWLPLVQRESGNPAIQSGQPGYFEAARYVTLREVPAVLD
RSHGDVHAGGNPHIQTDPRLYLKIGEALAERLALLDPAQAQAYQAGYRSFAERWKAAIAR
WEAKAAPLKGVPVLVQHDAFPYLNAWLGLKQVGVLEQKPGMEPSSGYLAEVLARQQHNPG
RMVLRPAYQYDAPSRWIADKAGIPSVILPFTVGGTAEAKDLFSLFDDTVNRLLAALR