Protein Info for Dsui_0580 in Dechlorosoma suillum PS

Annotation: ATP-dependent protease HslVU, ATPase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 445 (442 residues), 683.9 bits, see alignment E=5.3e-210 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 24.3 bits, see alignment 8.4e-09 PF00004: AAA" amino acids 53 to 107 (55 residues), 29.7 bits, see alignment 2.4e-10 amino acids 235 to 334 (100 residues), 29.7 bits, see alignment E=2.4e-10 PF07724: AAA_2" amino acids 193 to 331 (139 residues), 98.3 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 81% identical to HSLU_DECAR: ATP-dependent protease ATPase subunit HslU (hslU) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 82% identity to app:CAP2UW1_3846)

MetaCyc: 67% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFW9 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Dsui_0580 ATP-dependent protease HslVU, ATPase subunit (Dechlorosoma suillum PS)
MTQMTPQEIVHELDKHIVGQAQAKKAVAIALRNRWRRSQVEEGLRHEITPKNILMIGPTG
VGKTEIARRLARLANAPFIKIEATKFTEVGYVGRDVDTIIRDLMETAIKGQREQAMKRVR
ARAEDAAEDRVLDALLPPARGAGFFNENQGSSEDSTTRQKFRKKLREGELDDKEIDIEVA
APGMQAEIFAPPGMEELTSQIQGMFQSMGTARKKSRKLKIPEAMKLLVEEEAAKLVNDEE
VKLEALKNVEQNGIVFLDEIDKIASRSDAHGADVSRQGVQRDLLPLVEGTTVSTKYGMVK
TDHILFIASGAFHLAKPSDLIPELQGRLPIRVELDSLSVSDFEQILTQTDACLTRQYQAL
LGTEGLKLEFTADGIKRLAEIAYSVNEKTENIGARRLYTVMEKLLEEVSFTAGKSGAETL
TVDGAYVDARLGELSRDEDLSRYVL