Protein Info for Dsui_0573 in Dechlorosoma suillum PS

Annotation: ferredoxin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF05187: Fer4_ETF_QO" amino acids 17 to 89 (73 residues), 29.1 bits, see alignment E=4.8e-11

Best Hits

Swiss-Prot: 79% identical to FIXX_AZOVI: Ferredoxin-like protein (fixX) from Azotobacter vinelandii

KEGG orthology group: K03855, ferredoxin like protein (inferred from 80% identity to avn:Avin_10550)

MetaCyc: 79% identical to quinone reductase (NADH,flavodoxin) complex iron-sulfur prrotein subunit (Azotobacter vinelandii)
1.19.1.M1 [EC: 1.19.1.M1]

Predicted SEED Role

"Ferredoxin-like protein" in subsystem Acetyl-CoA fermentation to Butyrate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.19.1.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFW2 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Dsui_0573 ferredoxin-like protein (Dechlorosoma suillum PS)
MLKVEEKLFQDRYRVDSGRPHIQIKNPELCTHKCAEQQCTVCCPAGCYTQEGNGKVVLIS
DGCLECGTCRIICDEHRNLEWEWPRGGFGILFKFG