Protein Info for Dsui_0567 in Dechlorosoma suillum PS

Annotation: molybdenum-pterin binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00638: molybdenum-pterin binding domain" amino acids 137 to 203 (67 residues), 64.4 bits, see alignment E=3.9e-22 PF03459: TOBE" amino acids 139 to 200 (62 residues), 51.3 bits, see alignment E=1.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFV6 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Dsui_0567 molybdenum-pterin binding domain protein (Dechlorosoma suillum PS)
MNDQPVSDIADQLSPDRVAPLRLYPVAGIPGPFAVAAGHDRLAWLERAAVADALAVGAEA
AGEARRAAEELNNLAGERLAEWEAEDGGEGSGRLRLTPRGRRLAMVLVALAEERQLLRQR
CGGHFDADLQLLERVAVRTSARNQFCGRVQAVEQGPLLDQVLLALPGGRLLRASVTPEST
RCLGLAPGQELVALVKASATLVLGSGEGSDYADYNRLGGIVQRIQESGERREIVVDLGHG
LTGVANAGADLAEPFAPGQPAWIAFRPSAVLLGLVG