Protein Info for Dsui_0556 in Dechlorosoma suillum PS

Annotation: ferredoxin III, nif-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR02936: ferredoxin III, nif-specific" amino acids 8 to 96 (89 residues), 132.1 bits, see alignment E=3.2e-43 PF00037: Fer4" amino acids 22 to 42 (21 residues), 26.1 bits, see alignment 1.6e-09 PF13237: Fer4_10" amino acids 22 to 87 (66 residues), 30.1 bits, see alignment E=1.2e-10 PF12837: Fer4_6" amino acids 22 to 39 (18 residues), 25.4 bits, see alignment 3.1e-09 PF12838: Fer4_7" amino acids 26 to 90 (65 residues), 34.4 bits, see alignment E=7.2e-12

Best Hits

Swiss-Prot: 62% identical to FER3_LEPBY: Ferredoxin-3 (fdxB) from Leptolyngbya boryana

KEGG orthology group: None (inferred from 63% identity to lch:Lcho_1354)

Predicted SEED Role

"4Fe-4S ferredoxin, nitrogenase-associated" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFU5 at UniProt or InterPro

Protein Sequence (99 amino acids)

>Dsui_0556 ferredoxin III, nif-specific (Dechlorosoma suillum PS)
MSVFSVTLPSGVEWIPNFVQSIDDEKCIGCGRCFKTCGRDVLSLMAMDDEGELIAIDDGD
DDEYEKKVMTVAHPENCVGCEACARNCSKKCISHAPAKA