Protein Info for Dsui_0540 in Dechlorosoma suillum PS

Annotation: L-threonine-O-3-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR01140: threonine-phosphate decarboxylase" amino acids 4 to 327 (324 residues), 354.8 bits, see alignment E=2.3e-110 PF00155: Aminotran_1_2" amino acids 55 to 319 (265 residues), 111.1 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 52% identity to pmk:MDS_3108)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFE3 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Dsui_0540 L-threonine-O-3-phosphate decarboxylase (Dechlorosoma suillum PS)
MLEHGGRLRQAARQWGIPLADWLDLSTGINPWAYPIPGIPINAWQRLPEEEDGLEAAARN
YYGAKHVLALAGSQAAIQTLPKLLPPGRAAVLAPSYAEHAAAWVKAEWAVTPFAPPRLEE
VAKEHNVVVVVNPNNPTGERITARRLRAAARALAKRGGLLVVDEAFADADPRDSLADLAG
TKAAPNIIVLRSLGKFFGLAGARVGFAIGRPELLEALADTLGPWPVAGPARWVARCALED
RAWQADMRQELQVAAERLETLLQDSLGASTGTGLFRWLPHPRADWVYDELARRGILVRLF
LEVDGSSSLRFGLPGSDDEWRRLEGALNELRKDL