Protein Info for Dsui_0510 in Dechlorosoma suillum PS

Annotation: ferredoxin-type protein, NapH/MauN family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details TIGR02163: ferredoxin-type protein, NapH/MauN family" amino acids 23 to 278 (256 residues), 353.4 bits, see alignment E=3.8e-110 PF12801: Fer4_5" amino acids 83 to 126 (44 residues), 49.3 bits, see alignment 1.2e-16 amino acids 175 to 214 (40 residues), 28.2 bits, see alignment 4.6e-10 PF12838: Fer4_7" amino acids 225 to 274 (50 residues), 31.4 bits, see alignment 6.3e-11

Best Hits

Swiss-Prot: 55% identical to MAUN_METEA: Methylamine utilization ferredoxin-type protein MauN (mauN) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K02574, ferredoxin-type protein NapH (inferred from 67% identity to dar:Daro_3838)

Predicted SEED Role

"Polyferredoxin NapH (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFB4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Dsui_0510 ferredoxin-type protein, NapH/MauN family (Dechlorosoma suillum PS)
MSFLSPRFPAALAAKGRLGANRWLLLRRLSQFGILGLFLLGPLAGLWLVKGNLSYSLTLD
TLPLADPLLVLQVLFSGHRPEGLALLGAAIVLAFYLLVGGRVYCSWVCPMNLVTDLAGWL
RERLGLKGSAHISRRSRYWILGLTLLLPLAGAGLAWELINPVSMLHRGLIFGLGAAWTVV
LAIFLLDLLIMSRGWCGHLCPVGAFYGLLGRTSLLRVSARRRQECDDCMDCFAACPEPQV
IRPALKGEANGTGPVILASACTNCGRCIDVCAKDVFVFGSRFNQHTQRCAPAGEAEGQTD
HRKTIH