Protein Info for Dsui_0509 in Dechlorosoma suillum PS

Annotation: MauM/NapG family ferredoxin-type protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details TIGR00397: MauM/NapG family ferredoxin-type protein" amino acids 18 to 226 (209 residues), 246.9 bits, see alignment E=7.7e-78 PF13187: Fer4_9" amino acids 69 to 124 (56 residues), 27.1 bits, see alignment E=1.4e-09 PF00037: Fer4" amino acids 69 to 85 (17 residues), 21.5 bits, see alignment (E = 6.3e-08) PF12800: Fer4_4" amino acids 69 to 83 (15 residues), 19.3 bits, see alignment (E = 4.4e-07) amino acids 193 to 205 (13 residues), 11 bits, see alignment (E = 0.00022) PF12838: Fer4_7" amino acids 70 to 124 (55 residues), 34.2 bits, see alignment E=1.1e-11 amino acids 155 to 205 (51 residues), 29.1 bits, see alignment 4.3e-10 PF13237: Fer4_10" amino acids 142 to 205 (64 residues), 24.7 bits, see alignment E=7.2e-09

Best Hits

KEGG orthology group: K02573, ferredoxin-type protein NapG (inferred from 76% identity to app:CAP2UW1_3907)

Predicted SEED Role

"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFB3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Dsui_0509 MauM/NapG family ferredoxin-type protein (Dechlorosoma suillum PS)
MSDLSNSPPAKSDKAAAARRQFFADAGRMACGVGLLGLGLGFHAKQARALPPAALRPPGA
GAEEDFLGACIRCGLCVRDCPYGTLSLARPEQPVSTGTPYFVARQVPCEMCEDIPCVKAC
PTGALDHGLTDINQARMGLAVLLDQETCLNFLGLRCDVCYRVCPVIDKAITLELRPNTRT
GRHSMFIPTVHSEHCTGCGKCERSCVLETAAIKVLPVPLAKGELGQHYRVGWEEEKKAGH
SLVDDKGLGDLPDRMPEGARLEGHFDPASQGGPSLAPGKPATPGSGVDSLAPSIPGADAH
GPGVPAIPQNIPGGGLPNRLSDEAAR