Protein Info for Dsui_0491 in Dechlorosoma suillum PS

Annotation: putative oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase" amino acids 35 to 401 (367 residues), 367.7 bits, see alignment E=3.3e-114 PF04055: Radical_SAM" amino acids 38 to 207 (170 residues), 82.2 bits, see alignment E=5.2e-27 PF06969: HemN_C" amino acids 339 to 401 (63 residues), 53.5 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 68% identity to app:CAP2UW1_0939)

Predicted SEED Role

"Radical SAM family enzyme, similar to coproporphyrinogen III oxidase, oxygen-independent, clustered with nucleoside-triphosphatase RdgB" in subsystem Heat shock dnaK gene cluster extended or Heme and Siroheme Biosynthesis or Queuosine-Archaeosine Biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QF95 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Dsui_0491 putative oxygen-independent coproporphyrinogen III oxidase (Dechlorosoma suillum PS)
MSSRSHPSSRIIPIAVAGSTRAGGSPLHFTSPPPLSLYIHVPWCVKKCPYCDFNSHEARP
ENDEAAYVAALIADLESALPSVWGRKVSSIFIGGGTPSLLSGEALHELLNAVRMRLPLLP
EAEVTLEANPGTAEAGKFAAFRAAGVNRLSLGIQSFNDRHLEALGRIHDSAEARAAIELA
KTHFERFNLDLMYGLPQQSQAEAMADLETALSFAPPHLSCYQLTLEPNTLFAARPPQLPE
GDTCADMQDAIEACLAAAGYVHYETSAFARPGYQCRHNLNYWTFGDYLGIGAGAHGKLTL
PDHSGFSVQRQMRWKQPKQYLEQVAAGQPVQEQHGVGADELPFEFLMNALRLNQGFDPAL
FEQRTGLPLLLVRGELEKAAREGLLTLAPDCIAPTERGRRFLNALLERFLPG