Protein Info for Dsui_0489 in Dechlorosoma suillum PS

Annotation: DNA-binding regulatory protein, YebC/PmpR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 236 (236 residues), 312.9 bits, see alignment E=8.5e-98 PF20772: TACO1_YebC_N" amino acids 5 to 76 (72 residues), 126.7 bits, see alignment E=4e-41 PF01709: Transcrip_reg" amino acids 82 to 236 (155 residues), 199.6 bits, see alignment E=2.7e-63

Best Hits

Swiss-Prot: 81% identical to Y574_AZOSB: Probable transcriptional regulatory protein azo0574 (azo0574) from Azoarcus sp. (strain BH72)

KEGG orthology group: None (inferred from 81% identity to azo:azo0574)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QF93 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Dsui_0489 DNA-binding regulatory protein, YebC/PmpR family (Dechlorosoma suillum PS)
MAGHSKWANIQHRKGRQDAKRGKVFTKLIKEITVAAKMGGGDPAMNPRLRLAMEKAKGES
MPKDNIDNAIKRGTGQLEGVSYEEIRYEGYGIGGAAVMVDCLTDNRVRTVADVRHAFNKY
GGNMGTEGCVSFQFKHCGQMLFAPGADEAAIMDAAIEAGADDIITNDDGSIEVLTPPNDL
LNVQEALEKAGFKPEMAEVTMKALNESELTGEDAQRMQKLIDALESLDDVQEVYTSAVMD
E