Protein Info for Dsui_0488 in Dechlorosoma suillum PS

Annotation: EamA-like transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 205 to 231 (27 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 135 (129 residues), 60.6 bits, see alignment E=1e-20 amino acids 151 to 282 (132 residues), 36 bits, see alignment E=4.2e-13

Best Hits

KEGG orthology group: None (inferred from 73% identity to azo:azo0573)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QF92 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dsui_0488 EamA-like transporter family (Dechlorosoma suillum PS)
MRKFLPFLFVLLWSTGFIGAKYGLPYAEPLTFLSARYLLVLGLMLPVALVFRASWPDTRQ
EWLHIGFSGVLLHAVYLGGVFMAIHRGLPAGITALVVGMQPLLTALGAGWLLGEAVSRRQ
WLGLVLGLSGVGLVVSGKFGSQPLAELLPAIVPALVALLGITLGTLYQKRFCPAFDLRSG
AVIQFLPTAVLTLLVAGASESQEIAWSGTFVFALLWLVLVLSVGAISLLNVLIRSGSAVN
VASLFYLTPPTTALIAWAAFGETLSGPALAGMGLAVAGVYLARRA