Protein Info for Dsui_0486 in Dechlorosoma suillum PS

Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 22 to 173 (152 residues), 186.4 bits, see alignment E=1.6e-59 PF02075: RuvC" amino acids 22 to 169 (148 residues), 178.7 bits, see alignment E=3.5e-57

Best Hits

Swiss-Prot: 73% identical to RUVC_DECAR: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 73% identity to dar:Daro_4063)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QF90 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Dsui_0486 crossover junction endodeoxyribonuclease RuvC (Dechlorosoma suillum PS)
MSAIPPVSAKPNAAAAPVPVRILGIDPGLRCTGFGLIDKLGNKLAYVSSGCIRTDDTRTL
PERLEVIYQGIREIVAAHGPAQAAVEKVFVNVNPQSTLLLGQARGAAITALVSTGLPVGE
YTALQVKQAVVGNGKAAKEQVQHMVKRLLGLPGDPSADAADALACAIAHAHGGQGLGHIA
TAGLRVRGGRLMEAPNPRKRT