Protein Info for Dsui_0478 in Dechlorosoma suillum PS

Annotation: peptidoglycan-associated lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 64 to 167 (104 residues), 138.1 bits, see alignment E=5e-45 PF00691: OmpA" amino acids 66 to 161 (96 residues), 69.5 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 60% identity to dar:Daro_4052)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPN6 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Dsui_0478 peptidoglycan-associated lipoprotein (Dechlorosoma suillum PS)
MRKLALPALIASLFVLAGCGSQPAAPEQSGAGVENRSATATGVGGGDVGMKPYNDPKNVL
YKRSVYFDYDKFDIKPEYKELVAAHAKYLAANKGTKILIQGNTDERGSREYNLALGQKRS
DAVKKALSLLGVREEQLESVSLGEEKPKAEGNDEAAYAENRRADILYSGEF