Protein Info for Dsui_0467 in Dechlorosoma suillum PS

Annotation: lipid A export permease/ATP-binding protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 12 to 582 (571 residues), 778.3 bits, see alignment E=2.3e-238 PF00664: ABC_membrane" amino acids 28 to 298 (271 residues), 161.7 bits, see alignment E=3.1e-51 PF00005: ABC_tran" amino acids 360 to 509 (150 residues), 116.7 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 57% identical to MSBA_DECAR: Lipid A export ATP-binding/permease protein MsbA (msbA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 57% identity to dar:Daro_0154)

MetaCyc: 45% identical to ATP-binding lipopolysaccharide transport protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-236 [EC: 7.5.2.6]; 7.5.2.6 [EC: 7.5.2.6]

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPM5 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Dsui_0467 lipid A export permease/ATP-binding protein MsbA (Dechlorosoma suillum PS)
MSRQDLNTRALYFRLLGYVRPYWKAVALSLGATAILAATEPLFPALMKPLLDDGFIKSGS
FGNPIWIPLGIVGVFILRSIFSYFSSYGFSWVSNRVVTDIRDEMYQRLVRLPIAYFQKHG
SSVPLTKIAYDVNGVAVAATNVVVTILRDGLSVVGLLGWLLWLNWQLTLVCFALIPAIAW
SMRTFSWRMRRASRGSQEAVARMVEALQETSHCARVIKVFGGEAQEAGRFGQINNEVRRQ
GMRQAVASSATSPITHIFASIALAIVVYVALTQSASGSTSVGSFVSFITALLMLLAPLRR
LADVSAPLQRGLASAESVFQLLDEAPEADPGQTRLGRAEGRITLEQVTFRYPGAERDALA
GVSLDIAPGQTVALVGQSGGGKSTLAALVPRFYNPDSGCLRLDGHDLQELSLESLRRNIA
YVSQDVLLFNDTVAANIAYGATADASREQIEAAAEAAHALDFIRALPEGFDTVIGENGNR
LSGGQRQRLAIARALLKDAPVLILDEATSALDNESERAVQAALETLMQNRTTLVIAHRLS
TIESADKIVVLAQGAIVEQGTHAELLAREGAYASLYRLQFAEVA