Protein Info for Dsui_0447 in Dechlorosoma suillum PS

Annotation: putative esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF12697: Abhydrolase_6" amino acids 4 to 170 (167 residues), 28.6 bits, see alignment E=2.1e-10 PF05728: UPF0227" amino acids 4 to 185 (182 residues), 176.3 bits, see alignment E=6.3e-56

Best Hits

Swiss-Prot: 45% identical to YQIA_ECOL6: Esterase YqiA (yqiA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07000, (no description) (inferred from 62% identity to tmz:Tmz1t_3675)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPK5 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Dsui_0447 putative esterase (Dechlorosoma suillum PS)
MSGILYLHGFRSSPASFKARAVAEAMAARGLQERFFCPALSHEPRQAMVQAEAILAAEGP
LTLVGSSLGGFYATWLAERHGLRAVLVNPAVLAHLSLADYVGPQTNLYSGEEFQFTREHV
AQLQAMEVADLRPERYWLLVEEGDEVLDYRQAVARYRDARQTVLAGGDHSFTRFVDFVPQ
ILEFAGL