Protein Info for Dsui_0445 in Dechlorosoma suillum PS

Annotation: TonB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF03544: TonB_C" amino acids 211 to 277 (67 residues), 46.6 bits, see alignment E=3.8e-16 TIGR01352: TonB family C-terminal domain" amino acids 211 to 286 (76 residues), 52.3 bits, see alignment E=2.8e-18 PF13103: TonB_2" amino acids 224 to 269 (46 residues), 26.9 bits, see alignment 4.5e-10

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 64% identity to app:CAP2UW1_0284)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPK3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dsui_0445 TonB family protein (Dechlorosoma suillum PS)
MAAARLMPGFLARMDASSRNLTLAVGLSVLVHGLLLSLHFKFPDASRSLQDKALDIILVN
SKSARRPTHAQALAQANLDGGGNVEENRRAATPLPPSARQQAGSDLEQSRQRVRDMEAQQ
QRLLAEVKSKTRAPRQDSRESQPQNAPTLSGRDLASSAMAMARMEAEISKSVDEYNQRPR
KKNIGTRADEYRFARYVEDWRLKVERVGTLNYPEAARGRLYGTLVLSVTINANGSVDKVE
LERTSGHKVLDEAALRIVRMASPYAAFPEDIRRDVDQLVITRTWFFTSGDRVQAQ