Protein Info for Dsui_0443 in Dechlorosoma suillum PS

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 5 to 268 (264 residues), 274.2 bits, E=4.9e-86
• PF08501: Shikimate_dh_N
  • amino acids 7 to 89 (83 residues), 86.4 bits, E=1.9e-28
• PF01488: Shikimate_DH
  • amino acids 118 to 193 (76 residues), 31 bits, E=3.7e-11
• PF18317: SDH_C
  • amino acids 239 to 269 (31 residues), 41.6 bits, 1.2e-14

Best Hits

Swiss-Prot: 66% identical to AROE_DECAR: Shikimate dehydrogenase (NADP(+)) (aroE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 67% identity to app:CAP2UW1_0285)

MetaCyc: 53% identical to shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of chorismate metabolism (48/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See G8QPK1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Dsui_0443 shikimate 5-dehydrogenase (Dechlorosoma suillum PS)
MTDRYAVFGNPIGHSKSPLIHSLFAVACAQDMSYEALLAPLDGFAAALRAFADGGGRGAN
VTVPFKEEAFRLADSLTPRAARAGAVNTLVLEGGRILGDNTDGAGLVQDLQVNQSLPLAG
KAILLLGAGGASRGALAPLLAAGPCRLHIANRTAAKAADLARDFADLGPVSGGGYGELAG
QGFDVVINATSASLAGELPPLPPGIFNGGALAYDMMYGRGETPFLAFARLEGATHLVDGL
GMLVEQAAEAFQLWRGVRPATAPVLDRLRQG