Protein Info for Dsui_0443 in Dechlorosoma suillum PS

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR00507: shikimate dehydrogenase" amino acids 5 to 268 (264 residues), 274.2 bits, see alignment E=4.9e-86 PF08501: Shikimate_dh_N" amino acids 7 to 89 (83 residues), 83.9 bits, see alignment E=1.2e-27 PF01488: Shikimate_DH" amino acids 118 to 193 (76 residues), 31 bits, see alignment E=3.7e-11 PF18317: SDH_C" amino acids 239 to 269 (31 residues), 42 bits, see alignment 9.2e-15

Best Hits

Swiss-Prot: 66% identical to AROE_DECAR: Shikimate dehydrogenase (NADP(+)) (aroE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 67% identity to app:CAP2UW1_0285)

MetaCyc: 53% identical to shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPK1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Dsui_0443 shikimate 5-dehydrogenase (Dechlorosoma suillum PS)
MTDRYAVFGNPIGHSKSPLIHSLFAVACAQDMSYEALLAPLDGFAAALRAFADGGGRGAN
VTVPFKEEAFRLADSLTPRAARAGAVNTLVLEGGRILGDNTDGAGLVQDLQVNQSLPLAG
KAILLLGAGGASRGALAPLLAAGPCRLHIANRTAAKAADLARDFADLGPVSGGGYGELAG
QGFDVVINATSASLAGELPPLPPGIFNGGALAYDMMYGRGETPFLAFARLEGATHLVDGL
GMLVEQAAEAFQLWRGVRPATAPVLDRLRQG