Protein Info for Dsui_0442 in Dechlorosoma suillum PS

Annotation: monofunctional biosynthetic peptidoglycan transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 10 to 33 (24 residues), see Phobius details TIGR02070: monofunctional biosynthetic peptidoglycan transglycosylase" amino acids 16 to 229 (214 residues), 314.9 bits, see alignment E=1.4e-98 PF00912: Transgly" amino acids 57 to 224 (168 residues), 190.9 bits, see alignment E=6.8e-61

Best Hits

Swiss-Prot: 73% identical to MTGA_DECAR: Biosynthetic peptidoglycan transglycosylase (mtgA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 72% identity to app:CAP2UW1_0286)

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPK0 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dsui_0442 monofunctional biosynthetic peptidoglycan transglycosylase (Dechlorosoma suillum PS)
MRILHWLKLAAAWGVGLLLAYQLWLFAWVLWWANVNPHMTRFMEIRQEELWLKTPGASLQ
KQWVDYERISPHLKRAIIAAEDAKFVDHEGFDWDGIQKAVEKNQRRGKVVAGGSTISQQL
AKNLFLSPSKTPWRKAEEAAITLMLETAWSKRRIFEVYLNVVEWGNGVFGAEAAARHYFN
VSAAQLGPEQAAKLAAMLPNPRFYDRNRSAPGLLKKTGIILGRMGAAELP