Protein Info for Dsui_0441 in Dechlorosoma suillum PS

Annotation: Mg2+ transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 317 to 337 (21 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details amino acids 452 to 478 (27 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 41 to 479 (439 residues), 302.6 bits, see alignment E=2.3e-94 PF03448: MgtE_N" amino acids 64 to 165 (102 residues), 89.6 bits, see alignment E=2.5e-29 PF00571: CBS" amino acids 167 to 223 (57 residues), 22.2 bits, see alignment 2.3e-08 amino acids 231 to 286 (56 residues), 41.6 bits, see alignment 1.9e-14 PF01769: MgtE" amino acids 351 to 474 (124 residues), 117.3 bits, see alignment E=7.7e-38

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 78% identity to azo:azo0705)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPJ9 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Dsui_0441 Mg2+ transporter MgtE (Dechlorosoma suillum PS)
MSEEIQHADADELQARLSEVQTLLARHHLVEDLVHKQEMPRHELVESLVHKQHLNELRHK
LDKMHPADVAYILEALPLDERLMVWDLVKAERDGEILLEVSDAVRETLIANMDSDELVAA
AESLDADELADLAPDLPHEVIQDVFQSLSVEEREQLRAAMSYPEDSVGSIMDFEMVTVRE
DVTLEVVLRYLRRFDELPDHTDQLFVLDRDERLKGVLPLNKLLINDPESEVADVMISDFV
HLEPDDDAEEAAQAFERYDLVSAPVVDRDDRLVGRVTVNAVVDFIREESESELLAQAGLR
EEEDIFASVWNSVKNRWTWLAINLVTAFIASRVIGAFEGSIEKLVALAALMPIVAGIGGN
SGNQTITMIVRAIALGQIQPESARRLLHKELGVALINGLVWGGLLGVVSWWLYHSFQLGL
VMTGAMTLNLLLAATVGVVIPMTMQKFGRDPALGSSVLITAVTDSGGFFIFLGLATLFLL