Protein Info for Dsui_0434 in Dechlorosoma suillum PS

Annotation: ribonuclease, Rne/Rng family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR00757: ribonuclease, Rne/Rng family" amino acids 13 to 430 (418 residues), 513.1 bits, see alignment E=2.8e-158 PF10150: RNase_E_G" amino acids 126 to 397 (272 residues), 362.8 bits, see alignment E=1.1e-112 PF20833: RNase_E_G_Thio" amino acids 408 to 490 (83 residues), 29.2 bits, see alignment E=8.4e-11

Best Hits

Swiss-Prot: 53% identical to RNG_HAEIN: Ribonuclease G (rng) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 82% identity to eba:ebA3964)

MetaCyc: 56% identical to RNase G (Escherichia coli K-12 substr. MG1655)
Ribonuclease E. [EC: 3.1.26.12]

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.12, 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.26.12 or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPJ2 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Dsui_0434 ribonuclease, Rne/Rng family (Dechlorosoma suillum PS)
MPEEILINFTPQETRVAVMHQGVAQELHIERTASLGIVGNIYLGKVVRILPGMQSAFIDV
GLERTAFLHVADIWLPRHSEKNGEKGDGEGGMRPIERILTEGQSLVVQVIKDPIGTKGAR
LSTQISIAGRMLVYLPQEKHIGVSQRIEDEQEREQLRERLTRLVPEDEKGGFIVRTMAEN
ASDEELANDIEYLRKTWRGIKENSLRVAPPHLLYQELSLSQRVLRDFVNPETSRIVIDSR
ENFQKLKEFAALYTPKVLELLDHYTGERPLFDLHGVEDEIQKALARRVDLKSGGYLIIDQ
TEAMTTIDVNTGGFVGVRNFDDTIFKTNLEAAQTIARQLRLRNLGGIIIVDFIDMENPEH
RDAVLAEFNKALARDHTKMTVNGFTALGLVEMTRKRTRESLAHVLCETCPTCGGRGEVKT
ARTVCYEILRELLREARQFNAREYRILAAPSVIDLYLDEESQSLAMLSDFIGKAISLQAE
ASYNQEQYDIVLM