Protein Info for Dsui_0429 in Dechlorosoma suillum PS

Annotation: cystathionine beta-lyase/cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 77 to 94 (18 residues), see Phobius details PF01053: Cys_Met_Meta_PP" amino acids 14 to 379 (366 residues), 333 bits, see alignment E=9.1e-104

Best Hits

KEGG orthology group: None (inferred from 78% identity to tmz:Tmz1t_1446)

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPI7 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Dsui_0429 cystathionine beta-lyase/cystathionine gamma-synthase (Dechlorosoma suillum PS)
MSQSPAVPSLAPETQAARGTVPVDSTYRDIVPPLHLATTFERAGDGSYPGGRVYSRDGSP
AYDGPEALLKELEGGAAAALFASGMAAASAVLQALKPGARVVAPRAMYWALRNWMIQFAA
NWQLTLEFFADDAELAALLQRPADLVWLETPANPTWEITDIAAAAKAAHAAGARLVVDST
VPTPVFTRPLELGADVVMHSATKYLNGHSDVVAGALVTRTEDDFWQRIKTVRALGGAVLG
PFEAWLLARGMRTLFPRVRTAAASAAAIASHFHGHAKVGLVLYPGLPSHPGHAVAARQMQ
GGFGAMLSLRIAGGEAAAKAVAARLQVFQRATSLGSVESLVEHRASVEGPGTFCPDDLLR
LSVGIEATADLIADLEQALAGV