Protein Info for Dsui_0418 in Dechlorosoma suillum PS

Annotation: putative Na+-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF13593: SBF_like" amino acids 6 to 317 (312 residues), 331.3 bits, see alignment E=6.5e-103 PF01758: SBF" amino acids 41 to 216 (176 residues), 40.7 bits, see alignment E=2.2e-14

Best Hits

Swiss-Prot: 42% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 50% identity to afw:Anae109_3613)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPH6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Dsui_0418 putative Na+-dependent transporter (Dechlorosoma suillum PS)
MGFKFDWFMKGMLGAVLLAFLWPEPGAKGGFLQPELLNKLGVALVFYLNGLALSLASMKD
GALRWRVHLLVQCSTFLLFPLLGVALLWGSAGWMAAPLQIGFFYLCALPSTVSSSVALTI
AARGNVAAAVFNATLSSLIGVLLTPLWMAWVLHQSGGNFAVGPVIVDLLLWVVLPLALGQ
FSRPLLKDWASRHKGLLQKVDRITILLLVYTSFADTVKEGVWSRYNPLLLVETVAGCALL
FLLVLALTQWGARLLGMPRGDRIASVFCGSKKTLASGVPMAHLIFGANPAIGLILLPIMI
YHPLQLLAGGMLAQRWSSAEAAPS