Protein Info for Dsui_0413 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide/oligopeptide/nickel transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 71 (51 residues), 55.3 bits, see alignment 5.1e-19 PF00528: BPD_transp_1" amino acids 115 to 289 (175 residues), 79.3 bits, see alignment E=3.1e-26

Best Hits

Swiss-Prot: 39% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 84% identity to mms:mma_1403)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPH1 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Dsui_0413 ABC-type dipeptide/oligopeptide/nickel transport system, permease component (Dechlorosoma suillum PS)
MSATLPLPLPAAAAPAQPSRSYWTVVWRQLRRDPMAMASAAVLLLIVGAAVFAPWLAPAD
PYKASMIKRLLPIGSPGFLLGTDELGRDLFSRLMHGGRLSLLMGVVPVLAAFGIGTTIGL
LAGYVGGRVNMAIMRVLDIFYAFPSVLLAVAISGALGPGMSNSLIALTLVFVPQVVRVAE
SVTTQVRQLDYIEAARMSGAGAFSIIRTHVLGNVLGPVFVYATGLLSVSMILASGLSFLG
LGVKPPEPEWGLMLNTLRSAIYSNPWVAALPGVLIFVTSIAFNLLADSVRSAMDIRK