Protein Info for Dsui_0345 in Dechlorosoma suillum PS

Annotation: ribosomal protein S8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF00410: Ribosomal_S8" amino acids 5 to 130 (126 residues), 170.7 bits, see alignment E=6.7e-55

Best Hits

Swiss-Prot: 85% identical to RS8_DECAR: 30S ribosomal protein S8 (rpsH) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 85% identity to dar:Daro_0333)

MetaCyc: 65% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNW4 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Dsui_0345 ribosomal protein S8 (Dechlorosoma suillum PS)
MAMSDPIADMLTRIRNAQQAEKASVTMPCSKLKVAIADVLKGEGYIDDFAVREIEGKASL
EIALKYYAGRPVIERIERVSRPGLRVYKGSQDIPRVMNGLGVAIVSTPKGVMTDRKARTQ
NVGGEVLCIVA