Protein Info for Dsui_0342 in Dechlorosoma suillum PS

Annotation: ribosomal protein S5, bacterial/organelle type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 18 to 171 (154 residues), 198.5 bits, E=2.8e-63
• PF00333: Ribosomal_S5
  • amino acids 19 to 82 (64 residues), 84 bits, E=5.9e-28
• PF03719: Ribosomal_S5_C
  • amino acids 95 to 165 (71 residues), 99 bits, E=8.2e-33

Best Hits

Swiss-Prot: 85% identical to RS5_AROAE: 30S ribosomal protein S5 (rpsE) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 85% identity to eba:ebA3844)

MetaCyc: 69% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

See G8QNW1 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Dsui_0342 ribosomal protein S5, bacterial/organelle type (Dechlorosoma suillum PS)
MAKPQTKKPQQADERDDGLREKMISINRVTKVVKGGRILGFAALTVVGDGDGGVGMGKGK
SREVPVAVQKAMDEARRKMEKVSLKNGTLQHAVVGKHGSSTVLMMPAADGTGIIAGGAMR
AVFEVMGVTNVVAKAHGSTNPYNIVRATLNGLLAMNTPAEIAAKRGKSVEDILG