Protein Info for Dsui_0337 in Dechlorosoma suillum PS

Annotation: ribosomal protein L36, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 37 TIGR01022: ribosomal protein bL36" amino acids 1 to 37 (37 residues), 75.3 bits, see alignment E=1.5e-25 PF00444: Ribosomal_L36" amino acids 1 to 37 (37 residues), 72.8 bits, see alignment E=9.2e-25

Best Hits

Swiss-Prot: 92% identical to RL36_LEPCP: 50S ribosomal protein L36 (rpmJ) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K02919, large subunit ribosomal protein L36 (inferred from 92% identity to lch:Lcho_3927)

MetaCyc: 71% identical to 50S ribosomal subunit protein L36 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L36p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNV6 at UniProt or InterPro

Protein Sequence (37 amino acids)

>Dsui_0337 ribosomal protein L36, bacterial type (Dechlorosoma suillum PS)
MKVLASVKKICRNCKIIRRNGIVRVICTDPRHKQRQG