Protein Info for Dsui_0335 in Dechlorosoma suillum PS

Annotation: 30S ribosomal protein S11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR03632: ribosomal protein uS11" amino acids 10 to 126 (117 residues), 189.1 bits, see alignment E=1.4e-60 PF00411: Ribosomal_S11" amino acids 19 to 128 (110 residues), 173.4 bits, see alignment E=8.2e-56

Best Hits

Swiss-Prot: 95% identical to RS11_AROAE: 30S ribosomal protein S11 (rpsK) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 92% identity to app:CAP2UW1_3470)

MetaCyc: 73% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNV4 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Dsui_0335 30S ribosomal protein S11 (Dechlorosoma suillum PS)
MAKTAAKVRKKVKKNVAEGIAHIHASFNNTIITITDRQGNALSWATSGGAGFKGSRKSTP
FAAQVAAEAAGKAAQECGVKNLEVRIKGPGPGRESAVRALNALGMKITAISDVTPVPHNG
CRPPKKRRI