Protein Info for Dsui_0322 in Dechlorosoma suillum PS

Annotation: acyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 27 to 99 (73 residues), 62.5 bits, E=2e-21

Best Hits

Swiss-Prot: 45% identical to Y254_BUCBP: Uncharacterized acyl-CoA thioester hydrolase bbp_254 (bbp_254) from Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 65% identity to app:CAP2UW1_3461)

MetaCyc: 44% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA hydrolase (EC 3.1.2.20)" (EC 3.1.2.20)

MetaCyc Pathways

• palmitoleate biosynthesis IV (fungi and animals) (2/2 steps found)
• acyl-CoA hydrolysis (1/1 steps found)
• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (5/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

See G8QNE7 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Dsui_0322 acyl-CoA hydrolase (Dechlorosoma suillum PS)
MPEIPVQLPEKQPTLRLMTMPSDMNPNGDIFGGWVMSQVDIAGGVAAMRRARGRVTTVAV
NAFQFKQPISIGDVVSFYTDIVKVGRTSITLSVEVYAERNYFKPITVKVTEATLTYVAID
VSGNKREVPPEG