Protein Info for Dsui_0271 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver domain and winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00072: Response_reg" amino acids 14 to 123 (110 residues), 96.4 bits, see alignment E=1.2e-31 PF00486: Trans_reg_C" amino acids 157 to 233 (77 residues), 80 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 66% identical to KDPE_ECOLI: KDP operon transcriptional regulatory protein KdpE (kdpE) from Escherichia coli (strain K12)

KEGG orthology group: K07667, two-component system, OmpR family, KDP operon response regulator KdpE (inferred from 72% identity to pna:Pnap_3600)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN96 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Dsui_0271 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain (Dechlorosoma suillum PS)
MNPAAGQERLAPVVVIVEDEPQIRRFVRAALESEGCTVWEADTAARGLIEAGTRKPDLLV
LDLGLPDGDGVDLIRDLRNWSGVPVLVLSARSDESDKVAALDAGGDDYLTKPFGIPELLA
RVRALLRRAGRGGDMPPVFAFGPVEVDLARRQVSRHGEAVHLTPIEYRLLSQLVANAGRV
LTHRQLLREVWGPSHVEHAHYLRVYMAGLRRKLEDDPAMPRHILTESGVGYRLAV