Protein Info for Dsui_0265 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 33 to 180 (148 residues), 118.8 bits, see alignment E=3.9e-38 PF26769: HAMP_PhoQ" amino acids 207 to 253 (47 residues), 48.3 bits, see alignment 1.5e-16 PF00512: HisKA" amino acids 257 to 322 (66 residues), 57.2 bits, see alignment E=2.8e-19 PF02518: HATPase_c" amino acids 373 to 483 (111 residues), 85.6 bits, see alignment E=6.8e-28

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 67% identity to dar:Daro_0430)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN90 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Dsui_0265 signal transduction histidine kinase (Dechlorosoma suillum PS)
MKSRKNPAPAAKEGGDAQRSLFGEILDWMLAPLLFVWPISIAITHYFANIVAGYPYDQAL
RENVNAIARQIRYSDSKPVINLSGSARAVLRADEVDSVYFHVVTREGTRLAGDKELPVAP
ELVRPRDDTGEISFRDGEFNGQDLRIAYQFLADPNRPDDRWLVVEVGETLEKRSQLANKI
IASVILPQFVIIPLAVILVWFGLSQGLKPLTKLRSRIEARRPGDLSPINTRKVPEELQPL
IEAFNGMLERMERNMEAQTRFIADAAHQMRTPLTGLKTQAQLAMRENDPERLLYALRQMA
GAVDRASHLVNQLLTLARAEAGSGAASQPLAPMNLDKLLREIVEDWVMRALENYIDMGYE
PADGATEIEGNSFLLREMINNLIDNALRYTPVGGQVTCRVVRRRSEGGESEVVLEIEDSG
IGITEEQSELVFERFYRVDDAGTEGSGLGLPIVREIAELHHAQASLRPNPKGQGSIARVV
FPAYQEPRPELAEDAPLASAWNRSLPPPGSV