Protein Info for Dsui_0263 in Dechlorosoma suillum PS

Annotation: cytochrome c peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 30 to 30 (1 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details PF03150: CCP_MauG" amino acids 69 to 215 (147 residues), 179.3 bits, see alignment E=7.3e-57

Best Hits

KEGG orthology group: K00428, cytochrome c peroxidase [EC: 1.11.1.5] (inferred from 56% identity to azo:azo1279)

Predicted SEED Role

"Cytochrome c551 peroxidase (EC 1.11.1.5)" (EC 1.11.1.5)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.5

Use Curated BLAST to search for 1.11.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN89 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Dsui_0263 cytochrome c peroxidase (Dechlorosoma suillum PS)
MAKPAGLPNLRLFAVICVLAVTAVGALLYPRLAASPDAAVEPMPALLATTPIRPGEPLLP
LPDSLPVDPAKVALGRLLFNDPRLSRDDSLACAGCHDLQRGGADGMPVSRGVDGKKGGIN
APTVLNAAFNFRQFWDGRAATLEEQVEGPVHNPLEMAADWDQVLAKLQADKELRSRFASA
YPAGLTAATVRHAIAEYERSLLTPSRFDRWLRGDDTALSDEEKAGYRLFKRHGCSSCHQG
VNVGGNLFQRFGVMDNYFANKKALTAADMGRFNVTGRDEDRHVFKVPTLRNVALTAPYFH
DAATSSLEEAVALMGRYQLGVELPARDVTLIVTFLQSLNGDVRP