Protein Info for Dsui_0262 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 972 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 254 to 274 (21 residues), see Phobius details PF19443: DAHL" amino acids 34 to 255 (222 residues), 115.4 bits, see alignment E=1.4e-36 TIGR00229: PAS domain S-box protein" amino acids 286 to 411 (126 residues), 57.5 bits, see alignment E=1.5e-19 amino acids 417 to 532 (116 residues), 73.5 bits, see alignment E=1.7e-24 PF13188: PAS_8" amino acids 289 to 334 (46 residues), 29.5 bits, see alignment 2.2e-10 amino acids 416 to 458 (43 residues), 28.4 bits, see alignment (E = 5.1e-10) PF00989: PAS" amino acids 289 to 401 (113 residues), 38.1 bits, see alignment E=6.1e-13 amino acids 416 to 524 (109 residues), 46.2 bits, see alignment E=1.9e-15 PF08448: PAS_4" amino acids 297 to 403 (107 residues), 40.2 bits, see alignment E=1.6e-13 amino acids 418 to 529 (112 residues), 39.6 bits, see alignment E=2.4e-13 PF13426: PAS_9" amino acids 300 to 403 (104 residues), 43.4 bits, see alignment E=1.6e-14 amino acids 423 to 526 (104 residues), 55.8 bits, see alignment E=2.2e-18 PF08447: PAS_3" amino acids 436 to 519 (84 residues), 33.1 bits, see alignment E=2.4e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 535 to 696 (162 residues), 140.9 bits, see alignment E=3.2e-45 PF00990: GGDEF" amino acids 538 to 693 (156 residues), 174.9 bits, see alignment E=5.1e-55 PF00563: EAL" amino acids 715 to 950 (236 residues), 266.2 bits, see alignment E=1.1e-82

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN88 at UniProt or InterPro

Protein Sequence (972 amino acids)

>Dsui_0262 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTRLPSWKGAAPWLLVLILTVILVGLFQRSTGADVAEQARVEALVHEIVALDARLNQDLL
KLRHRQLQDYDAVAAADERISALLQRLQAELQRHGSEAMTPVLALWQEKREGLERFKQQN
ALLRNSQDHFLNLSSQLLRASDSPDGRGSVPHSALLATVGREIMEFLIRGEADDMPAVAA
DLSALQDQVVGWPLEVRRQVLLMTAHGQQVLRHRLDVESLLNELTGSPFAGSLEASYRDY
SEIYRQDLKQAESYRLLLALFALFLIATVVYIMVELKKSALELGHSHAFLDNIANTLAEG
ILALDRGGRITFANQRAEALLGAAPGGLLGRDAATVLWPGAAPAEVSGLARALATGAVFE
GEDDFVRSDGSAFPVAVLGAPLRGGEGDADQAGYVASFRDISEIKQAEARLHLAARVFDS
LGEAMVVTDARGRIQSVNPAFSEVTGYSEADARGRAPGHILASGQHDPAFYAQMWQSLQE
QGKWQGEVINRRKSGETYPEWLSITAIKDGAGQVSQYVGLFTDITDRKQAEAHIHHLAYH
DPLTGLPNRRLFYDRLENALRQAHRSRRKLAVLLLDLDRFKAVNDTLGHDQGDLLLKEVG
ARLSLCLREGDTLARLGGDEFVLLLPEVLSAEDASIVAGKLLAQFDQPVRLGEREIFAST
SIGIALYPADGEDGESLLKHADVAMYAAKDGGRAAYRFFIASHNERSLERLELENDLRRA
VEGEQLLLYYQPQIGASSGRIAGVEALVRWRHPTRGLVMPDSFIALAENAGLIDAIGHWC
LVAACRQLRAWQEQGVPVPRVAVNVSARQLRRWDFAQEVLQVVTQSGIDPAGLELELTES
SLADDPEQILAIFSTLRQAGVRVSIDDFGTGYSSLSYLSRYPVDEVKIDRSFVSRLLDDR
EARSVVRAVILLAHGLGMRTVAEGVETEAQWQVLSDLDCDELQGYLFSKPVPPHQIPLLK
GDWQRSESRLPV