Protein Info for Dsui_0259 in Dechlorosoma suillum PS

Annotation: sulfate ABC transporter, permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 62 to 86 (25 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 197 to 222 (26 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 13 to 271 (259 residues), 406 bits, see alignment E=7.1e-126 TIGR00969: sulfate ABC transporter, permease protein" amino acids 16 to 270 (255 residues), 317.5 bits, see alignment E=7.5e-99 PF00528: BPD_transp_1" amino acids 79 to 272 (194 residues), 47.9 bits, see alignment E=6.9e-17

Best Hits

Swiss-Prot: 50% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 78% identity to app:CAP2UW1_4674)

MetaCyc: 50% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMU8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Dsui_0259 sulfate ABC transporter, permease protein CysW (Dechlorosoma suillum PS)
MSVRRANTEPAWVRYTLLTLAFAFLALFLGVPLAAVFAEALRGGWEAYVNGLLDPEARSA
VTLTLAVAAIAVPLNVAFGIAASWAIAKFEFRGKSLLITLIDLPFAVSPVIAGLIFVLMF
GAQGYFGPWLAEHDVKIVFAVPGIILATLFVTFPFVAREMIPLMQAQGKDEEEAAVSLGA
SGFQMFWRVTLPNIKWGLLYGVILANARAMGEFGAVSVVSGHIRGETNTLPLHVEILYNE
YNAIGAFASASVLALLALVTLVAKTLVEWRMRAETAMLTAELPPEKTN