Protein Info for Dsui_0258 in Dechlorosoma suillum PS

Annotation: sulfate ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 242 (240 residues), 398 bits, see alignment E=6.9e-124 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 132.4 bits, see alignment E=5.4e-42 PF17850: CysA_C_terminal" amino acids 241 to 276 (36 residues), 33.5 bits, see alignment 1.5e-11 PF08402: TOBE_2" amino acids 269 to 335 (67 residues), 22.5 bits, see alignment E=3e-08 PF12857: TOBE_3" amino acids 282 to 335 (54 residues), 56.1 bits, see alignment 8.2e-19 PF03459: TOBE" amino acids 283 to 340 (58 residues), 27.5 bits, see alignment E=9.2e-10

Best Hits

Swiss-Prot: 62% identical to CYSA_NITEU: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 78% identity to eba:ebA6208)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMU7 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Dsui_0258 sulfate ABC transporter, ATP-binding protein (Dechlorosoma suillum PS)
MSIEIRNIAKRFGNFVALDDVSLSIPTGELVALLGPSGCGKTTLLRIIAGMETADEGQVM
FEGSEATHLHARERQVGFVFQHYALFRHMNVFENVAFGLRVKPRKERPCESEIRKRVMDL
LSLVQLDWLADRYPTQLSGGQRQRIALARALAVEPKVLLLDEPFGALDTKVRKELRRWLR
RLHDEMHISSVFVTHDQEEALEVADRVVVMNKGRIEQVGSPDEVYSNPASPFVYQFLGNV
NVFHSRVHGAWAEVARDDVPAGQEAVAFIRPHDIDIDTVATPESLEAKVSYVQTIGPLVR
VEVIHQGELVEVELTRERQQVLGLTAGQQVWLKPRQVKVFANGEGAVAPAQAQEKQPFLF