Protein Info for Dsui_0243 in Dechlorosoma suillum PS

Annotation: cell division protein FtsI/penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 41 to 43 (3 residues), see Phobius details PF03717: PBP_dimer" amino acids 67 to 213 (147 residues), 75.2 bits, see alignment E=9.5e-25 PF00905: Transpeptidase" amino acids 254 to 550 (297 residues), 265.4 bits, see alignment E=6.6e-83

Best Hits

Swiss-Prot: 46% identical to PBP2_NEIGO: Probable peptidoglycan D,D-transpeptidase PenA (penA) from Neisseria gonorrhoeae

KEGG orthology group: K03587, cell division protein FtsI (penicillin-binding protein 3) [EC: 2.4.1.129] (inferred from 73% identity to dar:Daro_3504)

Predicted SEED Role

"Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Flagellum in Campylobacter or Peptidoglycan Biosynthesis (EC 2.4.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMT3 at UniProt or InterPro

Protein Sequence (577 amino acids)

>Dsui_0243 cell division protein FtsI/penicillin-binding protein 2 (Dechlorosoma suillum PS)
MARARSHRYTESPVLQLAFPAWRSRLAALALLGGFAVLAGRSFYLQVINNDFLQEKGESR
YRRELEISASRGRITDRNGDVLAVSTPMRSIWAIPADVKLTPEQSQNLAKMLEMDGRELN
RRLAEDKNFVYLKRQIPPDTGERIAALKLPGIHQNKEYRRYYPSGDMTAHIVGFTGVDDK
GLEGVELAFQDQLLGRPGFRSVIKDRRGQIVEDVGSVKPPQDGKDITLALDSKIQYLAFS
QLKQAVDDNDAKAGGAVVVDARSGEILALANWPTYNPNNRANLSGAQLRNRAVTDTYEPG
STMKPFSAALALEKGKFRFDSVINTAPGKLTIGTATISDSHAHGLLTLAQVIQKSSNVGI
AKVAGTFPAEEMWTMFDNLGFGQAPKLGFPGEVGGRLRPWKTWRPIEQATMSYGHGISVS
LMQMVRAYTVFARDGELIPLTLLKGDGNPVKGERVFSPQTVREVRAMLEMAVQPGGTAPK
AQIPGYRVAGKTGTAHKLEGGVYARKYVASFVGLAPASDPRLIVAVMIDEPSSGKHFGGD
VAGPTFANIMSGALRTLGVPQDAALQVAGSNAGKEAL