Protein Info for Dsui_0240 in Dechlorosoma suillum PS

Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 39 to 367 (329 residues), 429.1 bits, see alignment E=6.4e-133 PF10555: MraY_sig1" amino acids 68 to 80 (13 residues), 21.5 bits, see alignment (E = 1.2e-08) PF00953: Glycos_transf_4" amino acids 99 to 285 (187 residues), 117.3 bits, see alignment E=6.9e-38

Best Hits

Swiss-Prot: 86% identical to MRAY_DECAR: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 86% identity to dar:Daro_3501)

MetaCyc: 56% identical to phospho-N-acetylmuramoyl-pentapeptide-transferase (Escherichia coli K-12 substr. MG1655)
Phospho-N-acetylmuramoyl-pentapeptide-transferase. [EC: 2.7.8.13]

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMT0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Dsui_0240 phospho-N-acetylmuramoyl-pentapeptide- transferase (Dechlorosoma suillum PS)
MLLLIAQWLGQDIRAFNVFNYITLRMVLAAMTSLLISFVAGPGVIRWLAAKKIGQAVRTD
GPQTHLVKTGTPTMGGVLILIAIGITTLLWGDLSNRYVWVVLVVTLGFGAVGWYDDWKKV
VYRDPNGLASRWKFFWQSVFGLAAAVYLGLSATGPAQTEVIIPFFKAFSYPLGVIGFITL
TYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAALAVFAYVAGHAGYAKYLFLPYVPGAGEL
AVFLGALCGAGLGFLWFNAYPAEVFMGDVGALALGAALGTVAVIVRQEIVLLIMGGVFVV
ETLSVMLQVSWFKYTKKRYGEGRRILLMAPLHHHFEQKGWKETQVVVRFWIITIMLVLFG
LSTLKLR