Protein Info for Dsui_0239 in Dechlorosoma suillum PS

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 284 to 304 (21 residues), see Phobius details PF21799: MurD-like_N" amino acids 6 to 82 (77 residues), 64.7 bits, see alignment E=1.2e-21 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 8 to 446 (439 residues), 375.5 bits, see alignment E=2.1e-116 PF08245: Mur_ligase_M" amino acids 114 to 289 (176 residues), 89 bits, see alignment E=6.6e-29 PF02875: Mur_ligase_C" amino acids 312 to 425 (114 residues), 49.7 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 68% identical to MURD_DECAR: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 68% identity to app:CAP2UW1_0573)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMS9 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Dsui_0239 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Dechlorosoma suillum PS)
MNVQGKQAVVVGLGESGLAMAKWLAREGARVRVADSRALPPNADAFRSAVPSAELVTGPF
QAATFAGADFIAISPGVPVEQVSAVAGAVPLVSEIELFAWALGRYSPAAKVIAITGSNGK
TTTTALTGALGAAAGLNTRVAGNISPAALDALMDALDGNDLPQLWVLELSSFQLETTHSL
NADAATVLNVSEDHLDRYAGSMDRYTEAKARIFQGKGAMILNRDDDRSLGLGRCGRNFVT
FGLDQPGRALDYGIADGCLMRGNDKLLALAEMQLTGLHNAANAMAALALLEAVGVAPAAV
LPALKAFKGLPHRVEHVARIGAVDYYDDSKGTNVGATLAAIEGLGRPLAIVLGGDGKGQD
FSPLKAALQQHGRAVALIGKDGPAIGQAIAGCGLPTESFADMAAAVAWLAAQAKAGDAVL
LSPACASLDMYKNYAHRAQAFIDAVQQLEGRA