Protein Info for Dsui_0214 in Dechlorosoma suillum PS

Annotation: TIGR02594 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR02594: TIGR02594 family protein" amino acids 6 to 136 (131 residues), 155.4 bits, see alignment E=5e-50 PF05257: CHAP" amino acids 39 to 116 (78 residues), 34.7 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 50% identity to ngk:NGK_2031)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMQ4 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dsui_0214 TIGR02594 family protein (Dechlorosoma suillum PS)
MQEPNWLTEARRHLGVAEIPGPKHNPVIQSWLHKLRAWWDDDETPWCGVFVAACMDTVGI
QLPANWMRAKVWADWGSRLSAPVPGCVVVFERQGGGHVGFVVGRTAGGNLMVLGGNQGNR
VSIAPFDRTRAVAYVWPAGVPMPPHAVLAVLDAGGAPLSTNEA