Protein Info for Dsui_0165 in Dechlorosoma suillum PS

Annotation: Obg family GTPase CgtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 337 (335 residues), 468.2 bits, see alignment E=6.3e-145 PF01018: GTP1_OBG" amino acids 4 to 158 (155 residues), 209.1 bits, see alignment E=4e-66 PF01926: MMR_HSR1" amino acids 161 to 285 (125 residues), 85.2 bits, see alignment E=5.3e-28 PF02421: FeoB_N" amino acids 162 to 217 (56 residues), 31.4 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 74% identical to OBG_DECAR: GTPase Obg (obg) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03979, GTP-binding protein (inferred from 74% identity to dar:Daro_3472)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM69 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Dsui_0165 Obg family GTPase CgtA (Dechlorosoma suillum PS)
MKFIDEAKILVIAGKGGNGVASFRREKYIPMGGPDGGDGGRGGSIYVIADRNINTLIDYR
YTRKFLAQNGESGRGADCYGKGGDDIIMHMPVGTVISDAVTGDVLADLDKDGKKVLLAQG
GRGGLGNIHFKSSTNRAPRQCTKGEPGEEKELKLELKVLADVGLLGLPNAGKSTFIRAVS
AARPKVADYPFTTLHPNLGVVRVDDNKSFVIADVPGLIEGAADGAGLGIRFLKHLARTRV
LLHIVDIAPMDPDADPVADAIAIVGELEKYSPELASKPRWLILNKLDLLPEEERQEHVGA
FLSAYRERSGFDGPVFPIAAISGEGCRPVVYAIQAALEEIRKQDEAAEESGESPLTPSPS
VDE