Protein Info for Dsui_0144 in Dechlorosoma suillum PS

Annotation: nitrate/TMAO reductase, membrane-bound tetraheme cytochrome c subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to NIRT_PSEST: Denitrification system component NirT (nirT) from Pseudomonas stutzeri

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 97% identity to dar:Daro_2579)

MetaCyc: 54% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
formate to nitrite electron transfer (1/3 steps found)
Fe(II) oxidation (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM50 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Dsui_0144 nitrate/TMAO reductase, membrane-bound tetraheme cytochrome c subunit (Dechlorosoma suillum PS)
MKNILKSLRQPSTKYSLLGLLSVGFIAGIFFWGGFNTVMEATNTLEFCISCHEMRDNVYQ
EYKETIHFANRTGVRAVCSDCHVPKDWGHKMMRKIQASGEVYGKLMGTIDTKEKFEAKRL
ELAEHEWARMKASDSRECRNCHSFEGMNTEKQKLRGAKMHKIAQDEKKTCIDCHKGIAHR
KPKGMKEDDDE