Protein Info for Dsui_0141 in Dechlorosoma suillum PS

Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 2 to 323 (322 residues), 331.4 bits, see alignment E=2.8e-103 PF13353: Fer4_12" amino acids 4 to 118 (115 residues), 24.6 bits, see alignment E=4e-09 PF04055: Radical_SAM" amino acids 16 to 175 (160 residues), 103.4 bits, see alignment E=2.4e-33 PF06463: Mob_synth_C" amino acids 183 to 306 (124 residues), 103.2 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 43% identical to MOAA_RHILO: GTP 3',8-cyclase (moaA) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: None (inferred from 89% identity to dar:Daro_2577)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM48 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dsui_0141 molybdenum cofactor biosynthesis protein A (Dechlorosoma suillum PS)
MLIDGCGRRIDYLRLSVTDRCDLRCAYCMPPEFDNYEIPDNWLTLSEIVRICKIFIDLGV
SRVRLTGGEPLVRSRIGNLVRDVGQLPGLNDLSLSTNGTRLAQFASNLLASGVTRLNVSL
DTLSPSRFLTLTRRDALHDVLAGLEVARESGFRLIKINMVWLPEFNGDELDAMITYCMER
NFVLRLIENMPMGDSARQLGTSSLQPLIGQLRERFQLVDHIVAGGGPARYLATRDRSFSV
GFITPMSQHFCEACNRVRVSVTGTLHLCLGQNDRLDLLPMLRGGSNDQEIADQIRAVVML
KPLRHEFETNPKKIIRIMASTGG