Protein Info for Dsui_0127 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF09339: HTH_IclR" amino acids 33 to 82 (50 residues), 49.4 bits, see alignment 4.8e-17 PF01614: IclR_C" amino acids 102 to 267 (166 residues), 144.7 bits, see alignment E=3.5e-46

Best Hits

KEGG orthology group: None (inferred from 79% identity to dar:Daro_0668)

Predicted SEED Role

"Predicted Lactate-responsive regulator, IclR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM34 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Dsui_0127 transcriptional regulator (Dechlorosoma suillum PS)
MAESASSAGKASPRAAAKTAGEKPESRSSIQVIERMMSLLDALSAQPDPASLKQLAQATQ
LHPSTAHRILAAMTHARFVERHDQGTYRLGIRLLELGNLVKSRINLREVALPFMQTLHET
IGEAINLGVRRDDEIVYIERTSSGRSLVRVVYLVGGSAPLHLTSVGKLFLAEAGAQEVKE
YAKRTGLPGKTPHSLTTMAALEKELDKIRRHGIAFDNEEAEIGLKCVAAPIHDDEGHLVA
CLSVSAPTDRHNPDWVDQVRRTADEISQALGYSKPRK