Protein Info for Dsui_0126 in Dechlorosoma suillum PS

Annotation: (4Fe-4S) cluster-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR00273: iron-sulfur cluster-binding protein" amino acids 46 to 461 (416 residues), 467 bits, see alignment E=2.9e-144 PF02589: LUD_dom" amino acids 74 to 301 (228 residues), 167 bits, see alignment E=1.5e-52 PF13183: Fer4_8" amino acids 316 to 384 (69 residues), 48.4 bits, see alignment E=4e-16 PF13534: Fer4_17" amino acids 319 to 384 (66 residues), 30.8 bits, see alignment E=1.2e-10 PF11870: LutB_C" amino acids 401 to 475 (75 residues), 32.9 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: None (inferred from 66% identity to eba:ebA4051)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM33 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Dsui_0126 (4Fe-4S) cluster-containing protein (Dechlorosoma suillum PS)
MEVKSLQFRARAAERLADPALQSKLGGAKQLFVGGRARVVAEFDSVGQAGDFETLRGIGA
EIRDTALTDLDAWLEAFEAKATATGATVLWARDGREAQQLIVDIAKRHGVKKVIKSKSML
SEEAGLNEGLEAAGVQSVETDLGEYILQLAKEPPSHILAPAIHKNKEEVDELFARCHGRP
VTPEGQIDIPALTREARVALREHFLSADMGITGGNFLVAETGSVALVTNEGNGRMVTTLP
RVHVAVVGIEKVIPTLEDLSALLRLLTRSATGQTISNYVSLLTGPRAEGAVEGPEHMYFV
LMDNGRAGLVGGDFQEMLRCIRCGACMNHCPVYQSIGGHAYGWVYPGPMGSVLTPLYTGL
EQAPDLPQAATLCGQCSIVCPVKIPLPELLRKLREKQMETELRPWQERWALRTWGFFAAR
PRLYALAAGLGARALKLLAGGKASIRTLPGVPEWSRGRDFPAPQGKTFRELYAARRRQD